PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G1484
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 390aa    MW: 44878.4 Da    PI: 7.0765
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G1484genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix86.53.3e-2771152286
     trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  W ++e++ Li++rrem+  ++++k++k+lWe++s+kmr++gf rsp++C++kw+nl k++kk k+++++     s +++y++++e
  Gh_D12G1484  71 WVQDETRSLIAFRREMDGLFNTSKSNKHLWEQISAKMRDKGFDRSPTMCTDKWRNLLKEFKKAKHQDRGS---GSAKMSYYKEIE 152
                  ********************************************************************84...556899***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-461132IPR009057Homeodomain-like
PROSITE profilePS500908.40963127IPR017877Myb-like domain
SMARTSM007171.4E-467129IPR001005SANT/Myb domain
CDDcd122032.74E-2969134No hitNo description
PfamPF138377.9E-2170154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MYLSEKPRSI DLYKEEGPAT ARDMIIDVTT NGDLPPHHHH HPPPHQQQII LGESSCEDPE  60
VKAPKKRAET WVQDETRSLI AFRREMDGLF NTSKSNKHLW EQISAKMRDK GFDRSPTMCT  120
DKWRNLLKEF KKAKHQDRGS GSAKMSYYKE IEEILRERTK NAYKSPTPPP KVDSYMHFAD  180
KGFEDAGMSF GPVEASGRPI LNLERRLDHE GHPLAIAAAD AVADSGVPPW NWRETPGNGV  240
DCQAYGGRVI TVKFGEYSRR IGIDGSADAI REAIKSAFRL RTKRAFLLED EDHIVRSLDR  300
EMPLGNYXLN VPYYLFIFKF LHSGLPIKVC LYDESDHIPV HTEEKIFYVE DDYREYLLRR  360
GYTGLREING YRNIDNLDDL RTNAIYRGVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A6e-5265150186DNA binding protein GT-1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.3070.0boll| ovule| root
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU8964138e-38KU896413.1 Hibiscus cannabinus microsatellite HC_ES_37_CTC sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438311.10.0PREDICTED: trihelix transcription factor GT-1-like isoform X1
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A0D2T7360.0A0A0D2T736_G
STRINGPOPTR_0008s17980.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28912768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.10.0Trihelix family protein